NT5C3A Polyclonal AntibodyNT5C3A Polyclonal Antibody
Move your mouse over image or click to enlarge

NT5C3A Polyclonal Antibody

Cat# Size Price Qty Buy
A14127-200ul 200ul
£332.50
A14127-100ul 100ul
£192.50
A14127-50ul 50ul
£113.75
A14127-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14127
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NT5C3A; NT5C3; P5'N-1; P5N-1; PN-I; POMP; PSN1; UMPH; UMPH1; cN-III; hUMP1; p36; cytosolic 5'-nucleotidase 3A
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 37-336 of human NT5C3A (NP_001002010.1).
Reactivity Human, Mouse, Rat
Gene ID 51251
Calculated MW 32kDa/33kDa/37kDa
Observed MW 38kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TLKRKTGRKTKIIEMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents