NSMF Polyclonal AntibodyNSMF Polyclonal Antibody
Move your mouse over image or click to enlarge

NSMF Polyclonal Antibody

Cat# Size Price Qty Buy
A4603-200ul 200ul
£332.50
A4603-100ul 100ul
£192.50
A4603-50ul 50ul
£113.75
A4603-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4603
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NSMF; HH9; NELF; NMDA receptor synaptonuclear signaling and neuronal migration factor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 226-505 of human NSMF (NP_001124443.1).
Reactivity Human, Mouse, Rat
Gene ID 26012
Calculated MW 44kDa/56kDa/57kDa/59kDa/60kDa
Observed MW 70kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FQTATTTMQANFRKHLRMVGSRRVKAQTFAERRERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKGLEAVACDTEGFVPPKVMLISSKVPKAEYIPTIIRRDDPSIIPILYDHEHATFEDILEEIERKLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRLYRLWKSRQHSKLLDFDDVL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents