NOXA1 Polyclonal AntibodyNOXA1 Polyclonal Antibody
Move your mouse over image or click to enlarge

NOXA1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13844-200ul 200ul
£332.50
A13844-100ul 100ul
£192.50
A13844-50ul 50ul
£113.75
A13844-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13844
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NOXA1; NY-CO-31; SDCCAG31; p51NOX; NADPH oxidase activator 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-300 of human NOXA1 (NP_006638.1).
Reactivity Human, Mouse, Rat
Gene ID 10811
Calculated MW 45kDa/50kDa/51kDa
Observed MW 51kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EAASSLREAMSKWPEGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLDAETEVGADRCTSTAYQEQRPQVEQVGKQAPLSPGLPAMGGPGPGPCEDPA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents