NOSTRIN Polyclonal AntibodyNOSTRIN Polyclonal Antibody
Move your mouse over image or click to enlarge

NOSTRIN Polyclonal Antibody

Cat# Size Price Qty Buy
A15938-20ul 20ul
£77.00
A15938-50ul 50ul
£113.75
A15938-100ul 100ul
£192.50
A15938-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15938
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NOSTRIN; DaIP2; nostrin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 207-506 of human NOSTRIN (NP_001034813.2).
Reactivity Mouse
Gene ID 115677
Calculated MW 48kDa/54kDa/57kDa/64kDa
Observed MW 57kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NCYQSILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFLLTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMDENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASSGGQSNPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEGGWWFGSLNGKKGHFPAAYVEELPSNAGNTATKA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents