NOS2 Polyclonal AntibodyNOS2 Polyclonal Antibody
Move your mouse over image or click to enlarge

NOS2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14031-200ul 200ul
£332.50
A14031-100ul 100ul
£192.50
A14031-50ul 50ul
£113.75
A14031-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14031
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NOS2; HEP-NOS; INOS; NOS; NOS2A; nitric oxide synthase 2
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 500-730 of human NOS2 (NP_000616.3).
Reactivity Human
Gene ID 4843
Calculated MW 126kDa/131kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVTILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPGNGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGDELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAK
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents