NOP58 Polyclonal AntibodyNOP58 Polyclonal Antibody
Move your mouse over image or click to enlarge

NOP58 Polyclonal Antibody

Cat# Size Price Qty Buy
A14129-200ul 200ul
£332.50
A14129-100ul 100ul
£192.50
A14129-50ul 50ul
£113.75
A14129-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14129
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NOP58; HSPC120; NOP5; NOP5/NOP58; nucleolar protein 58
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 360-529 of human NOP58 (NP_057018.1).
Reactivity Human, Mouse, Rat
Gene ID 51602
Calculated MW 59kDa
Observed MW 68kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents