NOP16 Polyclonal AntibodyNOP16 Polyclonal Antibody
Move your mouse over image or click to enlarge

NOP16 Polyclonal Antibody

Cat# Size Price Qty Buy
A14128-200ul 200ul
£332.50
A14128-100ul 100ul
£192.50
A14128-50ul 50ul
£113.75
A14128-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14128
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NOP16; HSPC111; HSPC185; nucleolar protein 16
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-178 of human NOP16 (NP_057475.2).
Reactivity Human, Mouse, Rat
Gene ID 51491
Calculated MW 21kDa/26kDa/27kDa
Observed MW 21kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents