NOL3 Polyclonal AntibodyNOL3 Polyclonal Antibody
Move your mouse over image or click to enlarge

NOL3 Polyclonal Antibody

Cat# Size Price Qty Buy
A14082-200ul 200ul
£332.50
A14082-100ul 100ul
£192.50
A14082-50ul 50ul
£113.75
A14082-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14082
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NOL3; ARC; FCM; MYP; NOP; NOP30; nucleolar protein 3
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-208 of human NOL3 (NP_003937.1).
Reactivity Human, Mouse
Gene ID 8996
Calculated MW 22kDa/24kDa/29kDa
Observed MW 28kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents