NMRAL1 Polyclonal AntibodyNMRAL1 Polyclonal Antibody
Move your mouse over image or click to enlarge

NMRAL1 Polyclonal Antibody

Cat# Size Price Qty Buy
A15874-20ul 20ul
£77.00
A15874-50ul 50ul
£113.75
A15874-100ul 100ul
£192.50
A15874-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15874
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NMRAL1; HSCARG; SDR48A1; NmrA like redox sensor 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-299 of human NMRAL1 (NP_065728.1).
Reactivity Mouse
Gene ID 57407
Calculated MW 33kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence LLKMPEKYVGQNIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYALRPDRDIELTLRLNPKALTLDQWLEQHKGDFNLL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents