NLGN2 Polyclonal AntibodyNLGN2 Polyclonal Antibody
Move your mouse over image or click to enlarge

NLGN2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14289-200ul 200ul
£332.50
A14289-100ul 100ul
£192.50
A14289-50ul 50ul
£113.75
A14289-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14289
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NLGN2; neuroligin-2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 15-180 of human NLGN2 (NP_065846.1).
Reactivity Mouse
Gene ID 57555
Calculated MW 90kDa
Observed MW 91kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRGVRRELNNEILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLPVWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDPGKKPVM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents