NKRF Polyclonal AntibodyNKRF Polyclonal Antibody
Move your mouse over image or click to enlarge

NKRF Polyclonal Antibody

Cat# Size Price Qty Buy
A4853-200ul 200ul
£332.50
A4853-100ul 100ul
£192.50
A4853-50ul 50ul
£113.75
A4853-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4853
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NKRF; ITBA4; NRF; NFKB repressing factor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 391-690 of human NKRF (NP_060014.2).
Reactivity Human, Mouse, Rat
Gene ID 55922
Calculated MW 77kDa/79kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YGTKKTSKHAAADEALKILQKTQPTYPSVKSSQCHTGSSPRGSGKKKDIKDLVVYENSSNPVCTLNDTAQFNRMTVEYVYERMTGLRWKCKVILESEVIAEAVGVKKTVKYEAAGEAVKTLKKTQPTVINNLKKGAVEDVISRNEIQGRSAEEAYKQQIKEDNIGNQLLRKMGWTGGGLGKSGEGIREPISVKEQHKREGLGLDVERVNKIAKRDIEQIIRNYARSESHTDLTFSRELTNDERKQIHQIAQKYGLKSKSHGVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMPQAN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents