NGF Polyclonal AntibodyNGF Polyclonal Antibody
Move your mouse over image or click to enlarge

NGF Polyclonal Antibody

Cat# Size Price Qty Buy
A14216-200ul 200ul
£332.50
A14216-100ul 100ul
£192.50
A14216-50ul 50ul
£113.75
A14216-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14216
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NGF; Beta-NGF; HSAN5; NGFB; nerve growth factor
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-241 of human NGF (NP_002497.2).
Reactivity Human, Mouse, Rat
Gene ID 4803
Calculated MW 26kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Sensitivity WB,1:500 - 1:1000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents