NFkB p100 / p52 Polyclonal AntibodyNFkB p100 / p52 Polyclonal Antibody
Move your mouse over image or click to enlarge

NFkB p100 / p52 Polyclonal Antibody

Cat# Size Price Qty Buy
A3108-200ul 200ul
£332.50
A3108-100ul 100ul
£192.50
A3108-50ul 50ul
£113.75
A3108-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3108
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NFKB2; CVID10; H2TF1; LYT-10; LYT10; NF-kB2; p100; p49/p100; p52; nuclear factor kappa B subunit 2
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 690-899 of human NFkB p100 / p52 (NP_002493.3).
Reactivity Human, Mouse, Rat
Gene ID 4791
Calculated MW 47kDa/96kDa
Observed MW 110kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents