NEXN Polyclonal AntibodyNEXN Polyclonal Antibody
Move your mouse over image or click to enlarge

NEXN Polyclonal Antibody

Cat# Size Price Qty Buy
A13136-200ul 200ul
£332.50
A13136-100ul 100ul
£192.50
A13136-50ul 50ul
£113.75
A13136-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13136
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NEXN; CMH20; NELIN; nexilin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 516-675 of human NEXN (NP_653174.3).
Reactivity Human, Mouse, Rat
Gene ID 91624
Calculated MW 72kDa/73kDa/79kDa/80kDa
Observed MW 81kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RFEQMAKAREEEEQRRIEEQKLLRMQFEQREIDAALQKKREEEEEEEGSIMNGSTAEDEEQTRSGAPWFKKPLKNTSVVDSEPVRFTVKVTGEPKPEITWWFEGEILQDGEDYQYIERGETYCLYLPETFPEDGGEYMCKAVNNKGSAASTCILTIESKN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents