NEUROD6 Polyclonal AntibodyNEUROD6 Polyclonal Antibody
Move your mouse over image or click to enlarge

NEUROD6 Polyclonal Antibody

Cat# Size Price Qty Buy
A15881-20ul 20ul
£77.00
A15881-50ul 50ul
£113.75
A15881-100ul 100ul
£192.50
A15881-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15881
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NEUROD6; Atoh2; MATH2; Math-2; NEX1M; Nex1; bHLHa2; neuronal differentiation 6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 188-337 of human NEUROD6 (NP_073565.2).
Reactivity Mouse, Rat
Gene ID 63974
Calculated MW 38kDa
Observed MW 39kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents