NEU3 Polyclonal AntibodyNEU3 Polyclonal Antibody
Move your mouse over image or click to enlarge

NEU3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13842-200ul 200ul
£332.50
A13842-100ul 100ul
£192.50
A13842-50ul 50ul
£113.75
A13842-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13842
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NEU3; SIAL3; sialidase-3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 222-461 of human NEU3 (NP_006647.3).
Reactivity Human
Gene ID 10825
Calculated MW 48kDa/51kDa
Observed MW 48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence CFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents