NECAB1 Polyclonal AntibodyNECAB1 Polyclonal Antibody
Move your mouse over image or click to enlarge

NECAB1 Polyclonal Antibody

Cat# Size Price Qty Buy
A15883-20ul 20ul
£77.00
A15883-50ul 50ul
£113.75
A15883-100ul 100ul
£192.50
A15883-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15883
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NECAB1; EFCBP1; STIP-1; N-terminal EF-hand calcium-binding protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-351 of human NECAB1 (NP_071746.1).
Reactivity Human, Mouse, Rat
Gene ID 64168
Calculated MW 11kDa/40kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEDSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFHTIDTHNTNNLDTEELCEYFSQHLGEYENVLAALEDLNLSILKAMGKTKKDYQEASNLEQFVTRFLLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSPQFNVSGPGLLEEDNQWMTQINRLQKLIDRLEKKDLKLEPPEEEIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKHYVESASSQSGCLRISIQKLSNESRYMIYEFWENSSVWNSHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILNN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents