NDUFS6 Polyclonal AntibodyNDUFS6 Polyclonal Antibody
Move your mouse over image or click to enlarge

NDUFS6 Polyclonal Antibody

Cat# Size Price Qty Buy
A3985-200ul 200ul
£332.50
A3985-100ul 100ul
£192.50
A3985-50ul 50ul
£113.75
A3985-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3985
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NDUFS6; CI-13kA; CI-13kD-A; CI13KDA; NADH:ubiquinone oxidoreductase subunit S6
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-124 of human NDUFS6 (NP_004544.1).
Reactivity Mouse, Rat
Gene ID 4726
Calculated MW 13kDa
Observed MW 14kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents