NDUFB3 Polyclonal AntibodyNDUFB3 Polyclonal Antibody
Move your mouse over image or click to enlarge

NDUFB3 Polyclonal Antibody

Cat# Size Price Qty Buy
A14378-200ul 200ul
£332.50
A14378-100ul 100ul
£192.50
A14378-50ul 50ul
£113.75
A14378-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14378
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NDUFB3; B12; CI-B12; NADH:ubiquinone oxidoreductase subunit B3
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human NDUFB3 (NP_002482.1).
Reactivity Human, Mouse
Gene ID 4709
Calculated MW 11kDa
Observed MW 11kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents