NDUFB2 Polyclonal AntibodyNDUFB2 Polyclonal Antibody
Move your mouse over image or click to enlarge

NDUFB2 Polyclonal Antibody

Cat# Size Price Qty Buy
A3978-200ul 200ul
£332.50
A3978-100ul 100ul
£192.50
A3978-50ul 50ul
£113.75
A3978-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3978
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NDUFB2; AGGG; CI-AGGG; NADH:ubiquinone oxidoreductase subunit B2
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 34-105 of human NDUFB2 (NP_004537.1).
Reactivity Human, Mouse, Rat
Gene ID 4708
Calculated MW 12kDa
Observed MW 12kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents