NDUFA5 Polyclonal AntibodyNDUFA5 Polyclonal Antibody
Move your mouse over image or click to enlarge

NDUFA5 Polyclonal Antibody

Cat# Size Price Qty Buy
A3976-200ul 200ul
£332.50
A3976-100ul 100ul
£192.50
A3976-50ul 50ul
£113.75
A3976-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3976
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NDUFA5; B13; CI-13KD-B; CI-13kB; NUFM; UQOR13; NADH:ubiquinone oxidoreductase subunit A5
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human NDUFA5 (NP_004991.1).
Reactivity Human, Mouse, Rat
Gene ID 4698
Calculated MW 13kDa
Observed MW 13kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents