NDUFA4L2 Polyclonal AntibodyNDUFA4L2 Polyclonal Antibody
Move your mouse over image or click to enlarge

NDUFA4L2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14288-200ul 200ul
£332.50
A14288-100ul 100ul
£192.50
A14288-50ul 50ul
£113.75
A14288-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14288
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NDUFA4L2; NUOMS; NDUFA4, mitochondrial complex associated like 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human NDUFA4L2 (NP_064527.1).
Reactivity Human, Mouse, Rat
Gene ID 56901
Calculated MW 9kDa
Observed MW 12kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 30710412
Sequence MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents