NDRG3 Polyclonal AntibodyNDRG3 Polyclonal Antibody
Move your mouse over image or click to enlarge

NDRG3 Polyclonal Antibody

Cat# Size Price Qty Buy
A15876-20ul 20ul
£77.00
A15876-50ul 50ul
£113.75
A15876-100ul 100ul
£192.50
A15876-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15876
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NDRG3; protein NDRG3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 184-363 of human NDRG3 (NP_071922.2).
Reactivity Human, Mouse
Gene ID 57446
Calculated MW 31kDa/39kDa/41kDa
Observed MW 41kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QEELQANLDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECNSRLNPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSLGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTMEVSC
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents