NCR2 Polyclonal AntibodyNCR2 Polyclonal Antibody
Move your mouse over image or click to enlarge

NCR2 Polyclonal Antibody

Cat# Size Price Qty Buy
A3657-200ul 200ul
£332.50
A3657-100ul 100ul
£192.50
A3657-50ul 50ul
£113.75
A3657-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3657
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NCR2; CD336; LY95; NK-p44; NKP44; dJ149M18.1; natural cytotoxicity triggering receptor 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-192 of human NCR2 (NP_004819.2).
Reactivity Human, Mouse, Rat
Gene ID 9436
Calculated MW 28kDa/29kDa/30kDa
Observed MW 44kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAPIA
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents