NCR1 Polyclonal AntibodyNCR1 Polyclonal Antibody
Move your mouse over image or click to enlarge

NCR1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14544-200ul 200ul
£332.50
A14544-100ul 100ul
£192.50
A14544-50ul 50ul
£113.75
A14544-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14544
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NCR1; CD335; LY94; NK-p46; NKP46; natural cytotoxicity triggering receptor 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 151-303 of human NCR1 (NP_001138929.2).
Reactivity Human, Mouse
Gene ID 9437
Calculated MW 21kDa/22kDa/23kDa/32kDa/34kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence SMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents