NCOA5 Polyclonal AntibodyNCOA5 Polyclonal Antibody
Move your mouse over image or click to enlarge

NCOA5 Polyclonal Antibody

Cat# Size Price Qty Buy
A3476-200ul 200ul
£332.50
A3476-100ul 100ul
£192.50
A3476-50ul 50ul
£113.75
A3476-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3476
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NCOA5; CIA; bA465L10.6; nuclear receptor coactivator 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human NCOA5 (NP_066018.1).
Reactivity Human
Gene ID 57727
Calculated MW 65kDa
Observed MW 65kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents