NCAM2 Polyclonal AntibodyNCAM2 Polyclonal Antibody
Move your mouse over image or click to enlarge

NCAM2 Polyclonal Antibody

Cat# Size Price Qty Buy
A3973-200ul 200ul
£332.50
A3973-100ul 100ul
£192.50
A3973-50ul 50ul
£113.75
A3973-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3973
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NCAM2; NCAM21; neural cell adhesion molecule 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 500-690 of human NCAM2 (NP_004531.2).
Reactivity Human, Mouse, Rat
Gene ID 4685
Calculated MW 47kDa/93kDa
Observed MW 140kDa
Physical Appearance liquid
Purification Affinity purification
Sequence YGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents