NAXE Polyclonal AntibodyNAXE Polyclonal Antibody
Move your mouse over image or click to enlarge

NAXE Polyclonal Antibody

Cat# Size Price Qty Buy
A15952-20ul 20ul
£77.00
A15952-50ul 50ul
£113.75
A15952-100ul 100ul
£192.50
A15952-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15952
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NAXE; AIBP; APOA1BP; PEBEL; YJEFN1; NAD(P)HX epimerase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 48-170 of human NAXE (NP_658985.2).
Reactivity Human, Mouse, Rat
Gene ID 128240
Calculated MW 20kDa/31kDa
Observed MW 32kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents