NANOG Polyclonal AntibodyNANOG Polyclonal Antibody
Move your mouse over image or click to enlarge

NANOG Polyclonal Antibody

Cat# Size Price Qty Buy
A3232-200ul 200ul
£332.50
A3232-100ul 100ul
£192.50
A3232-50ul 50ul
£113.75
A3232-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3232
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names NANOG; Nanog homeobox
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human NANOG (NP_079141.2).
Reactivity Human, Mouse, Rat
Gene ID 79923
Calculated MW 32kDa/34kDa
Observed MW 48kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 27891591|28642470|28497810
Sequence MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRT
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents