MZB1 Polyclonal AntibodyMZB1 Polyclonal Antibody
Move your mouse over image or click to enlarge

MZB1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14479-200ul 200ul
£332.50
A14479-100ul 100ul
£192.50
A14479-50ul 50ul
£113.75
A14479-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14479
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MZB1; MEDA-7; PACAP; pERp1; marginal zone B and B1 cell specific protein
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-189 of human MZB1 (NP_057543.2).
Reactivity Human, Mouse, Rat
Gene ID 51237
Calculated MW 6kDa/8kDa/10kDa/13kDa/20kDa
Observed MW 21kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents