MYOC Polyclonal AntibodyMYOC Polyclonal Antibody
Move your mouse over image or click to enlarge

MYOC Polyclonal Antibody

Cat# Size Price Qty Buy
A1589-20ul 20ul
£77.00
A1589-50ul 50ul
£113.75
A1589-100ul 100ul
£192.50
A1589-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A1589
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MYOC; GLC1A; GPOA; JOAG; JOAG1; TIGR; myocilin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 245-504 of human MYOC (NP_000252.1).
Reactivity Human, Mouse, Rat
Gene ID 4653
Calculated MW 56kDa
Observed MW 65kDa
Physical Appearance liquid
Purification Affinity purification
Sequence CGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSKM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents