MYLK2 Polyclonal AntibodyMYLK2 Polyclonal Antibody
Move your mouse over image or click to enlarge

MYLK2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14295-200ul 200ul
£332.50
A14295-100ul 100ul
£192.50
A14295-50ul 50ul
£113.75
A14295-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14295
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MYLK2; KMLC; MLCK; MLCK2; skMLCK; myosin light chain kinase 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human MYLK2 (NP_149109.1).
Reactivity Human, Mouse
Gene ID 85366
Calculated MW 64kDa
Observed MW 65kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASEKGDGTLAQPSTSSQGPKGEGDRGGGPAEGS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents