MYL9 Polyclonal AntibodyMYL9 Polyclonal Antibody
Move your mouse over image or click to enlarge

MYL9 Polyclonal Antibody

Cat# Size Price Qty Buy
A3039-200ul 200ul
£332.50
A3039-100ul 100ul
£192.50
A3039-50ul 50ul
£113.75
A3039-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3039
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MYL9; LC20; MLC-2C; MLC2; MRLC1; MYRL2; myosin light chain 9
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYL9 (NP_006088.2).
Reactivity Mouse, Rat
Gene ID 10398
Calculated MW 13kDa/19kDa
Observed MW 20kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents