MYL7 Polyclonal AntibodyMYL7 Polyclonal Antibody
Move your mouse over image or click to enlarge

MYL7 Polyclonal Antibody

Cat# Size Price Qty Buy
A4905-200ul 200ul
£332.50
A4905-100ul 100ul
£192.50
A4905-50ul 50ul
£113.75
A4905-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4905
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MYL7; MYL2A; MYLC2A; myosin light chain 7
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human MYL7 (NP_067046.1).
Reactivity Mouse
Gene ID 58498
Calculated MW 19kDa
Observed MW 19kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents