MYCBP Polyclonal AntibodyMYCBP Polyclonal Antibody
Move your mouse over image or click to enlarge

MYCBP Polyclonal Antibody

Cat# Size Price Qty Buy
A4623-200ul 200ul
£332.50
A4623-100ul 100ul
£192.50
A4623-50ul 50ul
£113.75
A4623-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4623
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MYCBP; AMY-1; MYC binding protein
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human MYCBP (NP_036465.2).
Reactivity Human
Gene ID 26292
Calculated MW 11kDa
Observed MW 12kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents