MYBBP1A Polyclonal AntibodyMYBBP1A Polyclonal Antibody
Move your mouse over image or click to enlarge

MYBBP1A Polyclonal Antibody

Cat# Size Price Qty Buy
A4429-200ul 200ul
£332.50
A4429-100ul 100ul
£192.50
A4429-50ul 50ul
£113.75
A4429-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4429
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MYBBP1A; P160; PAP2; Pol5; myb-binding protein 1A
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1104-1328 of human MYBBP1A (NP_055335.2).
Reactivity Human, Mouse, Rat
Gene ID 10514
Calculated MW 148kDa/149kDa
Observed MW 149kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DLTVLLGVLQGQQQSLQQGAHSTGSSRLHDLYWQAMKTLGVQRPKLEKKDAKEIPSATQSPISKKRKKKGFLPETKKRKKRKSEDGTPAEDGTPAATGGSQPPSMGRKKRNRTKAKVPAQANGTPTTKSPAPGAPTRSPSTPAKSPKLQKKNQKPSQVNGAPGSPTEPAGQKQHQKALPKKGVLGKSPLSALARKKARLSLVIRSPSLLQSGAKKKAQVRKAGKP
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents