MYB Polyclonal AntibodyMYB Polyclonal Antibody
Move your mouse over image or click to enlarge

MYB Polyclonal Antibody

Cat# Size Price Qty Buy
A13776-200ul 200ul
£332.50
A13776-100ul 100ul
£192.50
A13776-50ul 50ul
£113.75
A13776-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13776
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MYB; Cmyb; c-myb; c-myb_CDS; efg; transcriptional activator Myb
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYB (NP_005366.2).
Reactivity Human
Gene ID 4602
Calculated MW 37-46kDa/63-85kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEED
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents