MUC20 Polyclonal AntibodyMUC20 Polyclonal Antibody
Move your mouse over image or click to enlarge

MUC20 Polyclonal Antibody

Cat# Size Price Qty Buy
A15968-20ul 20ul
£77.00
A15968-50ul 50ul
£113.75
A15968-100ul 100ul
£192.50
A15968-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15968
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MUC20; MUC-20; mucin-20
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MUC20 (NP_689886.3).
Reactivity Human, Mouse, Rat
Gene ID 200958
Calculated MW 68kDa/71kDa
Observed MW 80kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PNFMVLIATSVETSAASGSPEGAGMTTVQTITGSDPEEAIFDTLCTDDSSEEAKTLTMDILTLAHTSTEAKGLSSESSASSDGPHPVITPSRASESSASSD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents