MTTP Polyclonal AntibodyMTTP Polyclonal Antibody
Move your mouse over image or click to enlarge

MTTP Polyclonal Antibody

Cat# Size Price Qty Buy
A14028-200ul 200ul
£332.50
A14028-100ul 100ul
£192.50
A14028-50ul 50ul
£113.75
A14028-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14028
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MTTP; ABL; MTP; microsomal triglyceride transfer protein
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human MTTP (NP_000244.2).
Reactivity Human, Mouse, Rat
Gene ID 4547
Calculated MW 16kDa/99kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRISSNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQRPTLLHLIHG
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents