MTMR9 Polyclonal AntibodyMTMR9 Polyclonal Antibody
Move your mouse over image or click to enlarge

MTMR9 Polyclonal Antibody

Cat# Size Price Qty Buy
A13124-200ul 200ul
£332.50
A13124-100ul 100ul
£192.50
A13124-50ul 50ul
£113.75
A13124-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13124
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MTMR9; C8orf9; LIP-STYX; MTMR8; myotubularin-related protein 9
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human MTMR9 (NP_056273.2).
Reactivity Human, Mouse, Rat
Gene ID 66036
Calculated MW 53kDa/63kDa
Observed MW 63kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDKRFVGSLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVIEDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKVATFRHGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLNVAQQTRAKGG
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents