MTM1 Polyclonal AntibodyMTM1 Polyclonal Antibody
Move your mouse over image or click to enlarge

MTM1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13517-200ul 200ul
£332.50
A13517-100ul 100ul
£192.50
A13517-50ul 50ul
£113.75
A13517-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13517
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MTM1; CNM; MTMX; XLMTM; myotubularin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 484-603 of human MTM1 (NP_000243.1).
Reactivity Mouse, Rat
Gene ID 4534
Calculated MW 66kDa/69kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SARERQKVTERTVSLWSLINSNKEKFKNPFYTKEINRVLYPVASMRHLELWVNYYIRWNPRIKQQQPNPVEQRYMELLALRDEYIKRLEELQLANSAKLSDPPTSPSSPSQMMPHVQTHF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents