MTA1 Polyclonal AntibodyMTA1 Polyclonal Antibody
Move your mouse over image or click to enlarge

MTA1 Polyclonal Antibody

Cat# Size Price Qty Buy
A16085-20ul 20ul
£77.00
A16085-50ul 50ul
£113.75
A16085-100ul 100ul
£192.50
A16085-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16085
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MTA1; metastasis associated 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MTA1 (NP_004680.2).
Reactivity Human, Mouse
Gene ID 9112
Calculated MW 49kDa/79kDa/80kDa
Observed MW 81kDa, 90kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LMPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents