MSH4 Polyclonal AntibodyMSH4 Polyclonal Antibody
Move your mouse over image or click to enlarge

MSH4 Polyclonal Antibody

Cat# Size Price Qty Buy
A14027-200ul 200ul
£332.50
A14027-100ul 100ul
£192.50
A14027-50ul 50ul
£113.75
A14027-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14027
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MSH4; mutS homolog 4
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 697-936 of human MSH4 (NP_002431.2).
Reactivity Human, Rat
Gene ID 4438
Calculated MW 104kDa
Observed MW 105kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QIMAQIGSYVPAEYSSFRIAKQIFTRISTDDDIETNSSTFMKEMKEIAYILHNANDKSLILIDELGRGTNTEEGIGICYAVCEYLLSLKAFTLFATHFLELCHIDALYPNVENMHFEVQHVKNTSRNKEAILYTYKLSKGLTEEKNYGLKAAEVSSLPPSIVLDAKEITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIYLSNLKKKYKEDFPRTEQVPEKTEE
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents