MRPS35 Polyclonal AntibodyMRPS35 Polyclonal Antibody
Move your mouse over image or click to enlarge

MRPS35 Polyclonal Antibody

Cat# Size Price Qty Buy
A15878-20ul 20ul
£77.00
A15878-50ul 50ul
£113.75
A15878-100ul 100ul
£192.50
A15878-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15878
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MRPS35; HDCMD11P; MDS023; MRP-S28; MRPS28; mitochondrial ribosomal protein S35
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human MRPS35 (NP_068593.2).
Reactivity Human, Mouse
Gene ID 60488
Calculated MW 21kDa/36kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents