MRPL45 Polyclonal AntibodyMRPL45 Polyclonal Antibody
Move your mouse over image or click to enlarge

MRPL45 Polyclonal Antibody

Cat# Size Price Qty Buy
A13197-200ul 200ul
£332.50
A13197-100ul 100ul
£192.50
A13197-50ul 50ul
£113.75
A13197-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13197
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MRPL45; L45mt; MRP-L45; mitochondrial ribosomal protein L45
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 57-306 of human MRPL45 (NP_115727.5).
Reactivity Human, Mouse, Rat
Gene ID 84311
Calculated MW 35kDa
Observed MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MQHARKAGLVIPPEKSDRSIHLACTAGIFDAYVPPEGDARISSLSKEGLIERTERMKKTMASQVSIRRIKDYDANFKIKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTEHCFPDMTWDIKYKTVRWSFVESLEPSHVVQVRCSSMMNQGNVYGQITVRMHTRQTLAIYDRFGRLMYGQEDVPKDVLEYVVFEKQLTNPYGSWRMHTKIVPPWAPPKQPILKTVMIPGPQLKPEEEYEEAQGEAQKPQLA
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents