MRPL22 Polyclonal AntibodyMRPL22 Polyclonal Antibody
Move your mouse over image or click to enlarge

MRPL22 Polyclonal Antibody

Cat# Size Price Qty Buy
A14586-200ul 200ul
£332.50
A14586-100ul 100ul
£192.50
A14586-50ul 50ul
£113.75
A14586-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14586
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MRPL22; HSPC158; L22mt; MRP-L22; MRP-L25; RPML25; mitochondrial ribosomal protein L22
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 97-206 of human MRPL22 (NP_054899.2).
Reactivity Mouse, Rat
Gene ID 29093
Calculated MW 13kDa/14kDa/23kDa
Observed MW 24kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents