MRPL1 Polyclonal AntibodyMRPL1 Polyclonal Antibody
Move your mouse over image or click to enlarge

MRPL1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4947-200ul 200ul
£332.50
A4947-100ul 100ul
£192.50
A4947-50ul 50ul
£113.75
A4947-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4947
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MRPL1; BM022; L1MT; MRP-L1; mitochondrial ribosomal protein L1
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 51-325 of human MRPL1 (NP_064621.3).
Reactivity Human
Gene ID 65008
Calculated MW 36kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KKTKKGAKEKTPDEKKDEIEKIKAYPYMEGEPEDDVYLKRLYPRQIYEVEKAVHLLKKFQILDFTSPKQSVYLDLTLDMALGKKKNVEPFTSVLSLPYPFASEINKVAVFTENASEVKIAEENGAAFAGGTSLIQKIWDDEIVADFYVAVPEIMPELNRLRKKLNKKYPKLSRNSIGRDIPKMLELFKNGHEIKVDEERENFLQTKIATLDMSSDQIAANLQAVINEVCRHRPLNLGPFVVRAFLRSSTSEGLLLKIDPLLPKEVKNEESEKEDA
Sensitivity WB,1:500 - 1:2000|IHC,1:20 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents