MOXD1 Polyclonal AntibodyMOXD1 Polyclonal Antibody
Move your mouse over image or click to enlarge

MOXD1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4600-200ul 200ul
£332.50
A4600-100ul 100ul
£192.50
A4600-50ul 50ul
£113.75
A4600-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4600
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MOXD1; MOX; PRO5780; dJ248E1.1; monooxygenase DBH like 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 390-590 of human MOXD1 (NP_056344.2).
Reactivity Human, Mouse, Rat
Gene ID 26002
Calculated MW 62kDa/69kDa
Observed MW 75kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AHLAGRGIRLRHFRKGKEMKLLAYDDDFDFNFQEFQYLKEEQTILPGDNLITECRYNTKDRAEMTWGGLSTRSEMCLSYLLYYPRINLTRCASIPDIMEQLQFIGVKEIYRPVTTWPFIIKSPKQYKNLSFMDAMNKFKWTKKEGLSFNKLVLSLPVNVRCSKTDNAEWSIQGMTALPPDIERPYKAEPLVCGTSSSSSLH
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents