MMS19 Polyclonal AntibodyMMS19 Polyclonal Antibody
Move your mouse over image or click to enlarge

MMS19 Polyclonal Antibody

Cat# Size Price Qty Buy
A4922-200ul 200ul
£332.50
A4922-100ul 100ul
£192.50
A4922-50ul 50ul
£113.75
A4922-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4922
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MMS19; MET18; MMS19L; hMMS19; MMS19 nucleotide excision repair protein homolog
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 761-1030 of human MMS19 (NP_071757.4).
Reactivity Mouse
Gene ID 64210
Calculated MW 3kDa/35kDa/102kDa/108kDa/113kDa/115kDa
Observed MW 113kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FAGLLNKHPAGQQLDEFLQLAVDKVEAGLGSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPQDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKPLDDKKRLVRKEAVSARGEWFLLGSPGS
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents