MMP25 Polyclonal AntibodyMMP25 Polyclonal Antibody
Move your mouse over image or click to enlarge

MMP25 Polyclonal Antibody

Cat# Size Price Qty Buy
A15886-20ul 20ul
£77.00
A15886-50ul 50ul
£113.75
A15886-100ul 100ul
£192.50
A15886-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15886
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names MMP25; MMP-25; MMP20; MMP20A; MMPL1; MT-MMP 6; MT-MMP6; MT6-MMP; MT6MMP; MTMMP6; matrix metallopeptidase 25
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-540 of human MMP25 (NP_071913.1).
Reactivity Human, Mouse, Rat
Gene ID 64386
Calculated MW 62kDa
Observed MW 75kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVFSWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKGAHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQAA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents